PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000134.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 575aa    MW: 64308 Da    PI: 4.3937
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000134.1_g00028.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.4e-53101371128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yL++kv +k+l++ ++i+e+diykvePwdLp  +++k+++ ewyfFs  dkky +g+r+nrat++gyWk
  Itr_sc000134.1_g00028.1  10 LAPGFRFHPTDEELVFYYLRRKVCAKPLRF-DAISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSMLDKKYGNGSRTNRATEKGYWK 94 
                              579*************************99.99***************6347788888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd++v + ++++vg+kktLv+++grap+g++++Wvmheyrl
  Itr_sc000134.1_g00028.1  95 TTGKDRAVNH-RSKVVGMKKTLVYHSGRAPRGQRSNWVMHEYRL 137
                              *********9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-628160IPR003441NAC domain
PROSITE profilePS5100558.39610160IPR003441NAC domain
PfamPF023653.4E-2712137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MESRGSSQLL APGFRFHPTD EELVFYYLRR KVCAKPLRFD AISEIDIYKV EPWDLPGMSR  60
LKTRDLEWYF FSMLDKKYGN GSRTNRATEK GYWKTTGKDR AVNHRSKVVG MKKTLVYHSG  120
RAPRGQRSNW VMHEYRLVDE DLSKAGIVQD AFVLCRVFQK SGAGPKNGEQ YGAPFVEEEW  180
EDDEIAMVPK ADLPEEAELA DDIFLDGDDL EQILGADIPL DGALVPVNNT TGNIEDAAAH  240
VEDFENILVD NVEYPCGLQH PDEPKPFDQP IHDFDPKPVK REYMGESSNS MTSENVNCLL  300
NEPLMDASDG FQFNDGTFLE TNDLSNPVEA NTSGFDMFDF LNFYDAKDDF QDVLFDSDIF  360
IGNDEFLEEQ SPFADKDVCD TTEQAVLPNE KSVDAEHKND IASSSKPEPT KLGSDFQHPF  420
IKQASQMLGN IPAPPAFASE FPKDAALRLN AATQASSSVH VTAGLIQISD LTLGSSKHGN  480
YNIILSFDFL QGAQSPASLE PVGHGKMLSG GWLYFLLFWV LILSISFKVG TFIYARCWQG  540
ILSTFVTINV TNCLKHSTRQ TGDVAFSGFC ELEKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-461016015168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764398.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_016467787.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ949N01e-153NAC53_ARATH; NAC domain-containing protein 53
TrEMBLK4C2M30.0K4C2M3_SOLLC; Uncharacterized protein
STRINGSolyc05g055470.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-154NAC domain containing protein 53